Asrgl1 Antibody - C-terminal region : FITC

Asrgl1 Antibody - C-terminal region : FITC
SKU
AVIARP53783_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Asrgl1 acts in asparagine catabolism. Asrgl1 may be involved in astroglial production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: ALFHVEQGKTVEEAAQLALDYMKSKLKGLGGLILVNKTGDWVAKWTSASM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: L-asparaginase

Protein Size: 326

Purification: Affinity Purified
More Information
SKU AVIARP53783_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53783_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 66514
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×