ATG12 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG12

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: KFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin-like protein ATG12

Protein Size: 187

Purification: Affinity Purified

• SKU: AVIARP54265_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54265_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 9140
• Host: Rabbit
• Conjugate: Conjugated, HRP