ATG16L1 Antibody - middle region : FITC

ATG16L1 Antibody - middle region : FITC
SKU
AVIARP54272_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy.Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy (Mizushima et al., 2003 [PubMed 12665549]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG16L1

Key Reference: Hancock,L., (er) Inflamm. Bowel Dis. (2008) In press

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: TSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Autophagy-related protein 16-1

Protein Size: 607

Purification: Affinity Purified
More Information
SKU AVIARP54272_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54272_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55054
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×