ATG3 Antibody - middle region : Biotin

ATG3 Antibody - middle region : Biotin
SKU
AVIARP54271_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG3

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: LWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin-like-conjugating enzyme ATG3

Protein Size: 314

Purification: Affinity Purified
More Information
SKU AVIARP54271_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54271_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64422
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×