ATG5 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ATG5 is required for autophagy. It conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. ATG5 may play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ATG5

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Autophagy protein 5

Protein Size: 275

Purification: Affinity Purified

• SKU: AVIARP54267_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54267_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 9474
• Host: Rabbit
• Conjugate: Conjugated, FITC