ATP6V0D2 Antibody - middle region : Biotin

ATP6V0D2 Antibody - middle region : Biotin
SKU
AVIARP55487_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0D2

Key Reference: Fridy,P.C., (2003) Biol. Cell 95 (7), 453-457

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: V-type proton ATPase subunit d 2

Protein Size: 350

Purification: Affinity Purified

Subunit: d 2
More Information
SKU AVIARP55487_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55487_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 245972
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×