Atp6v1b1 Antibody - N-terminal region : Biotin

Atp6v1b1 Antibody - N-terminal region : Biotin
SKU
AVIARP56326_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Atp6v1b1

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: PRVTYRTVCSVNGPLVVLDQVKFAQYAEIVNFTLPDGTQRSGQVLEVAGT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ATPase, H+ transporting, lysosomal V1 subunit B1 EMBL AAH17127.1

Protein Size: 513

Purification: Affinity Purified

Subunit: B, kidney isoform
More Information
SKU AVIARP56326_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56326_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 110935
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×