ATXN7L1 Antibody - middle region : Biotin

ATXN7L1 Antibody - middle region : Biotin
SKU
AVIARP55521_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of ATXN7L1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATXN7L1

Key Reference: Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ataxin 7-like 4, isoform CRA_a EMBL EAW83370.1

Protein Size: 146

Purification: Affinity Purified
More Information
SKU AVIARP55521_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55521_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 222255
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×