AURKC Antibody : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK

Molecular Weight: 36 kDa

Peptide Sequence: Synthetic peptide located within the following region: PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aurora kinase C

Protein Size: 309

Purification: Affinity Purified

• SKU: AVIARP53573_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53573_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Human Gene ID: 6795
• Host: Rabbit
• Conjugate: Conjugated, FITC