AXUD1 Antibody - middle region : Biotin

AXUD1 Antibody - middle region : Biotin
SKU
AVIARP57693_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein that localizes to the nucleus and expression of this gene is induced in response to elevated levels of axin. The Wnt signalling pathway, which is negatively regulated by axin, is important in axis formation in early development and impaired regulation of this signalling pathway is often involved in tumors. A decreased level of expression of this gene in tumors compared to the level of expression in their corresponding normal tissues suggests that this gene product has a tumor suppressor function.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AXUD1

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 589

Purification: Affinity Purified
More Information
SKU AVIARP57693_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57693_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64651
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×