B2M Antibody - N-terminal region : HRP

B2M Antibody - N-terminal region : HRP
SKU
AVIARP56555_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fib

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human B2M

Key Reference: Platt,G.W., (2008) J. Mol. Biol. 378 (1), 251-263

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Beta-2-microglobulin

Protein Size: 119

Purification: Affinity Purified
More Information
SKU AVIARP56555_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56555_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 567
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×