Blmh Antibody - C-terminal region : Biotin

Blmh Antibody - C-terminal region : Biotin
SKU
AVIARP56105_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The encoded protein is a cytoplasmic cysteine peptidase involved in inactivation of bleomycin, a glycopeptide which is a component of combination chemotherapy regimens for cancer. This encoded enzyme is highly conserved, and it contains the signature active site residues of cysteine protease papain superfamily enzymes. It is postulated that this enzyme has protective effects against bleomycin-induced pulmonary fibrosis and bleomycin tumor resistance.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Blmh

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: GPITPLQFYKEHVKPLFNMEDKICFVNDPRPQHKYNKLYTVDYLSNMVGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Bleomycin hydrolase

Protein Size: 455

Purification: Affinity Purified
More Information
SKU AVIARP56105_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56105_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 104184
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×