BPGM Antibody - C-terminal region : HRP

BPGM Antibody - C-terminal region : HRP
SKU
AVIARP58218_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration. It can also catalyze the reaction of EC 5.4.2.1 (mutase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BPGM

Key Reference: Wang,Y., (2006) J. Biol. Chem. 281 (51), 39642-39648

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Bisphosphoglycerate mutase

Protein Size: 259

Purification: Affinity Purified
More Information
SKU AVIARP58218_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58218_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 669
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×