BPGM Antibody - middle region : Biotin

BPGM Antibody - middle region : Biotin
SKU
AVIARP58217_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration. It can also catalyze the reaction of EC 5.4.2.1 (mutase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BPGM

Key Reference: Wang,Y., (2006) J. Biol. Chem. 281 (51), 39642-39648

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Bisphosphoglycerate mutase

Protein Size: 259

Purification: Affinity Purified
More Information
SKU AVIARP58217_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58217_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 669
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×