BXDC2 Antibody - middle region : Biotin

BXDC2 Antibody - middle region : Biotin
SKU
AVIARP57201_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: BXDC2 is required for biogenesis of the 60S ribosomal subunit.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BXDC2

Key Reference: 0

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribosome biogenesis protein BRX1 homolog

Protein Size: 353

Purification: Affinity Purified
More Information
SKU AVIARP57201_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57201_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55299
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×