C11orf16 Antibody - middle region : Biotin

C11orf16 Antibody - middle region : Biotin
SKU
AVIARP57427_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of C11orf16 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf16

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: EPCLGKPGTRYSNICKEEKDHKQQRAQTAVVGTTKELVSKATHMKPPRTP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C11orf16

Protein Size: 467

Purification: Affinity Purified
More Information
SKU AVIARP57427_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57427_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56673
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×