C12orf24 Antibody - N-terminal region : Biotin

C12orf24 Antibody - N-terminal region : Biotin
SKU
AVIARP54929_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of C12orf24 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf24

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM216A

Protein Size: 273

Purification: Affinity Purified
More Information
SKU AVIARP54929_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54929_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29902
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×