C12orf42 Antibody - N-terminal region : Biotin

C12orf42 Antibody - N-terminal region : Biotin
SKU
AVIARP54542_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of C12orf42 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf42

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C12orf42

Protein Size: 360

Purification: Affinity Purified
More Information
SKU AVIARP54542_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54542_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 374470
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×