C13orf30 Antibody - N-terminal region : Biotin

C13orf30 Antibody - N-terminal region : Biotin
SKU
AVIARP53425_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C13orf30

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM216B

Protein Size: 139

Purification: Affinity Purified
More Information
SKU AVIARP53425_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53425_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 144809
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×