C14orf140 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: C14orf140 belongs to the UPF0418 family. The exact function of C14orf140 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf140

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: QQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger C2HC domain-containing protein 1C

Protein Size: 275

Purification: Affinity Purified

• SKU: AVIARP53770_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53770_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 79696
• Host: Rabbit
• Conjugate: Conjugated, Biotin