C17orf81 Antibody - C-terminal region : Biotin

C17orf81 Antibody - C-terminal region : Biotin
SKU
AVIARP53845_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: C17orf81 belongs to the ELP5 family. C17orf81 may be involved in TP53-mediated transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C17orf81

Key Reference: Yuan,J., (2006) Mol. Biol. Rep. 33 (3), 151-158

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Elongator complex protein 5

Protein Size: 279

Purification: Affinity Purified
More Information
SKU AVIARP53845_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53845_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23587
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×