C17orf81 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: C17orf81 belongs to the ELP5 family. C17orf81 may be involved in TP53-mediated transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C17orf81

Key Reference: Yuan,J., (2006) Mol. Biol. Rep. 33 (3), 151-158

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Elongator complex protein 5

Protein Size: 279

Purification: Affinity Purified

• SKU: AVIARP53845_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53845_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23587
• Host: Rabbit
• Conjugate: Conjugated, HRP