C17orf97 Antibody : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC

Molecular Weight: 50 kDa

Peptide Sequence: Synthetic peptide located within the following region: GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C17orf97

Protein Size: 453

Purification: Affinity Purified

• SKU: AVIARP54432_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54432_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Horse (Equine)
• Clonality: Polyclonal
• Human Gene ID: 400566
• Host: Rabbit
• Conjugate: Conjugated, Biotin