C1orf103 Antibody - middle region : HRP

C1orf103 Antibody - middle region : HRP
SKU
AVIARP56174_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf103

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ligand-dependent nuclear receptor-interacting factor 1

Protein Size: 769

Purification: Affinity Purified
More Information
SKU AVIARP56174_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56174_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55791
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×