C1orf103 Antibody - N-terminal region : FITC

C1orf103 Antibody - N-terminal region : FITC
SKU
AVIARP56173_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf103

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ligand-dependent nuclear receptor-interacting factor 1

Protein Size: 233

Purification: Affinity Purified
More Information
SKU AVIARP56173_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56173_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55791
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×