C1orf190 Antibody - middle region : Biotin

C1orf190 Antibody - middle region : Biotin
SKU
AVIARP56202_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf190

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine rich adaptor protein 1

Protein Size: 239

Purification: Affinity Purified
More Information
SKU AVIARP56202_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56202_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 541468
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×