C20orf10 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C20orf10 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C20orf10

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: TSLAAMPRKEKHIEPEVPRTSRDDSLNPGVQGRQPLTEGPRVIFIKPYRN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TP53-target gene 5 protein

Protein Size: 290

Purification: Affinity Purified

• SKU: AVIARP53699_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53699_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27296
• Host: Rabbit
• Conjugate: Conjugated, FITC