C20orf10 Antibody - N-terminal region : FITC

C20orf10 Antibody - N-terminal region : FITC
SKU
AVIARP53698_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C20orf10 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf10

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TP53-target gene 5 protein

Protein Size: 290

Purification: Affinity Purified
More Information
SKU AVIARP53698_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53698_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27296
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×