C20orf111 Antibody - N-terminal region : Biotin

C20orf111 Antibody - N-terminal region : Biotin
SKU
AVIARP56915_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf111

Key Reference: Clerk,A., (2007) Physiol. Genomics 29 (2), 118-127

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C20orf111

Protein Size: 292

Purification: Affinity Purified
More Information
SKU AVIARP56915_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56915_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51526
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×