C2orf42 Antibody - C-terminal region : FITC

C2orf42 Antibody - C-terminal region : FITC
SKU
AVIARP53727_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C2orf42 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf42

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C2orf42

Protein Size: 574

Purification: Affinity Purified
More Information
SKU AVIARP53727_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53727_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54980
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×