C2orf42 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of C2orf42 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf42

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLSCKNKTCGTIF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C2orf42

Protein Size: 574

Purification: Affinity Purified

• SKU: AVIARP53726_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53726_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54980
• Host: Rabbit
• Conjugate: Conjugated, HRP