C3orf49 Antibody - middle region : Biotin

C3orf49 Antibody - middle region : Biotin
SKU
AVIARP53537_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C3orf49

Molecular Weight: 33

Peptide Sequence: Synthetic peptide located within the following region: IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative uncharacterized protein C3orf49

Protein Size: 292

Purification: Affinity Purified
More Information
SKU AVIARP53537_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53537_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 132200
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×