C5orf36 Antibody - N-terminal region : HRP

C5orf36 Antibody - N-terminal region : HRP
SKU
AVIARP55682_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of C5orf36 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C5orf36

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein KIAA0825

Protein Size: 324

Purification: Affinity Purified
More Information
SKU AVIARP55682_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55682_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285600
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×