C5orf39 Antibody - N-terminal region : Biotin

C5orf39 Antibody - N-terminal region : Biotin
SKU
AVIARP54435_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: C5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C5orf39

Key Reference: Lu,G., (2006) J. Biol. Chem. 281 (41), 30542-30550

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Annexin-2 receptor

Protein Size: 193

Purification: Affinity Purified
More Information
SKU AVIARP54435_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54435_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 389289
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×