C6orf154 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf154

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 73

Protein Size: 316

Purification: Affinity Purified

• SKU: AVIARP54422_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54422_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 221424
• Host: Rabbit
• Conjugate: Conjugated, Biotin