C6orf173 Antibody - N-terminal region : FITC

C6orf173 Antibody - N-terminal region : FITC
SKU
AVIARP54417_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: C6orf173 is up-regulated in many cancer tissues. It suggests that C6orf173 may act as an oncogene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf173

Key Reference: Lee,S., (2007) Biochem. Biophys. Res. Commun. 360 (3), 633-639

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centromere protein W

Protein Size: 88

Purification: Affinity Purified
More Information
SKU AVIARP54417_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54417_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 387103
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×