C6orf173 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: C6orf173 is up-regulated in many cancer tissues. It suggests that C6orf173 may act as an oncogene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf173

Key Reference: Lee,S., (2007) Biochem. Biophys. Res. Commun. 360 (3), 633-639

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centromere protein W

Protein Size: 88

Purification: Affinity Purified

• SKU: AVIARP54417_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54417_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 387103
• Host: Rabbit
• Conjugate: Conjugated, HRP