C6orf199 Antibody - middle region : Biotin

C6orf199 Antibody - middle region : Biotin
SKU
AVIARP55457_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf199

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: IINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEVIENHRKKKKEAQK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Adenylate kinase domain-containing protein 1

Protein Size: 421

Purification: Affinity Purified
More Information
SKU AVIARP55457_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55457_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221264
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×