C9orf40 Antibody - middle region : Biotin

C9orf40 Antibody - middle region : Biotin
SKU
AVIARP57082_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of C9orf40 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf40

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: HNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C9orf40

Protein Size: 194

Purification: Affinity Purified
More Information
SKU AVIARP57082_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57082_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55071
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×