C9orf68 Antibody - middle region : HRP

C9orf68 Antibody - middle region : HRP
SKU
AVIARP56259_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf68

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Spermatogenesis associated 6-like protein

Protein Size: 392

Purification: Affinity Purified
More Information
SKU AVIARP56259_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56259_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55064
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×