C9orf75 Antibody - middle region : HRP

C9orf75 Antibody - middle region : HRP
SKU
AVIARP55692_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of C9orf75 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf75

Key Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 433

Purification: Affinity Purified
More Information
SKU AVIARP55692_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55692_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 286262
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×