C9orf95 Antibody - N-terminal region : Biotin

C9orf95 Antibody - N-terminal region : Biotin
SKU
AVIARP57055_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of C9orf95 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C9orf95

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nicotinamide riboside kinase 1

Protein Size: 199

Purification: Affinity Purified
More Information
SKU AVIARP57055_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57055_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54981
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×