C9orf95 Antibody - N-terminal region : HRP

C9orf95 Antibody - N-terminal region : HRP
SKU
AVIARP57055_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of C9orf95 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C9orf95

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nicotinamide riboside kinase 1

Protein Size: 199

Purification: Affinity Purified
More Information
SKU AVIARP57055_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57055_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54981
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×