CAMK1G Antibody - N-terminal region : Biotin

CAMK1G Antibody - N-terminal region : Biotin
SKU
AVIARP57417_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAMK1G

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium/calmodulin-dependent protein kinase type 1G

Protein Size: 476

Purification: Affinity Purified
More Information
SKU AVIARP57417_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57417_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57172
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×