Camk2b Antibody - middle region : Biotin

Camk2b Antibody - middle region : Biotin
SKU
AVIARP55353_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Camk2b is a beta subunit of calcium/calmodulin-dependent protein kinase II; It may be involved in retinal development,

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Camk2b

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium/calmodulin-dependent protein kinase II, beta 3 isoform EMBL CAA58289.1

Protein Size: 589

Purification: Affinity Purified

Subunit: beta
More Information
SKU AVIARP55353_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55353_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 24245
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×