CARD8 Antibody - N-terminal region : FITC

CARD8 Antibody - N-terminal region : FITC
SKU
AVIARP55119_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CARD8

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase recruitment domain-containing protein 8

Protein Size: 286

Purification: Affinity Purified
More Information
SKU AVIARP55119_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55119_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22900
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×