CARD9 Antibody - middle region : FITC

CARD9 Antibody - middle region : FITC
SKU
AVIARP57704_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD). CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CARD9

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase recruitment domain-containing protein 9

Protein Size: 536

Purification: Affinity Purified
More Information
SKU AVIARP57704_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57704_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64170
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×