CCDC110 Antibody - middle region : Biotin

CCDC110 Antibody - middle region : Biotin
SKU
AVIARP55544_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC110

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: KEELKKHSQENIKFENSISRLTEDKILLENYVRSIENERDTLEFEMRHLQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 110

Protein Size: 833

Purification: Affinity Purified
More Information
SKU AVIARP55544_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55544_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 256309
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×