CCDC184 Antibody - middle region : HRP

CCDC184 Antibody - middle region : HRP
SKU
AVIARP54427_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC387856

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: LQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: coiled-coil domain-containing protein 184

Protein Size: 194

Purification: Affinity Purified
More Information
SKU AVIARP54427_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54427_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 387856
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×