CCDC190 Antibody - N-terminal region : HRP

CCDC190 Antibody - N-terminal region : HRP
SKU
AVIARP55775_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf110

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: coiled-coil domain-containing protein 190

Protein Size: 302

Purification: Affinity Purified
More Information
SKU AVIARP55775_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55775_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 339512
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×